Product Added to your Cart
x

-------- OR --------

USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Menu
0 items
Russian
2 product(s) found for "Russian"
Russian Army Colonel Full Of..
Post-WWII/Modern Era
Russian Army Colonel Full Of..
Russian Army Colonel Full Officer Uniform Set Hat, Coat, Breeches, Boots, Medals SOLD! Cold War era Russian Colonel of Chemical Troops! Chemical warfare is scary stuff! Starting at the Top:...
$195.00
Units in Stock: 0
$195.00
Details
Add To Cart
Russian Army Colonel Full Officer Uniform Set Hat, Coat, Breeches, Boots, Medals SOLD! Cold War era Russian Colonel of Chemical Troops! Chemical warfare is scary stuff! Starting at the Top:...
Russian Samovar, Late 1800s
Victorian Era
Russian Samovar, Late 1800s
Original Imperial Russian Tea Samovar Late 1800s, Functional, Romanov, Czar Nicholas II SOLD! This Beautiful, highly detailed, and fully functional antique Russian Samovar will be the central focus of...
$995.00
Units in Stock: 0
$995.00
Details
Add To Cart
Original Imperial Russian Tea Samovar Late 1800s, Functional, Romanov, Czar Nicholas II SOLD! This Beautiful, highly detailed, and fully functional antique Russian Samovar will be the central focus of...
Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i